DPCstruct | MC44434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 193 ± 11 aa |
| Standard deviation of domain lengths | 10.78 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 72.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 51.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0QF32 | 339-531 | STSVSEVTDDVFEPQSMGWEFDEPEPTWLKKVINRQKFLISQMDPSARYESSLSPIWWRIIDASDLKSTSDFLTEADMSDLVAVFAS… |
| A0A2I1E522 | 3-174 | WEFDEPEPAWLKKVINRQKFLISQMDPSARYESSLSPIWWRIIDASDLKSTSDFLTEADMSDLVAVFASALNVGHPTEDWTILEPSV… |
| A0A015KMU4 | 1-212 | None |
| A0A2N1NS23 | 127-319 | None |
| A0A433QS21 | 8-197 | None |
| A0A433D983 | 146-348 | None |
| A0A2H5TFF1 | 42-231 | None |
| A0A015JSN3 | 127-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.