DPCstruct | MC44432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 171 |
|---|---|
| Mean domain length (aa) | 522 ± 94 aa |
| Standard deviation of domain lengths | 93.82 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 13.00 |
| Pfam Score | 56.03 |
| Assigned Pfam label(s) | CL0052- PF12449- CL0033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B1EUY9 | 20-540 | ISPIPLLPSLPKNKKWYLLPRDEENSYGKIIYPRDEGGFINSSSQNMCYILEDIIKIPRLAIYDYWRMFVIPFLESQIPRNIDIVVE… |
| A0A7K2IAA7 | 2-444 | DTVLALVRDAGLEPGDEPWLGALALPDEDGELAPAGELVFPGSPFARVIREDELAAVDQELADKWGEQPLTACGVLATFALVRATDV… |
| A0A1R0GPN1 | 48-665 | None |
| A0A1A9FYT7 | 365-802 | None |
| A0A816WA63 | 4-316 | None |
| A0A815VEL8 | 403-1047 | None |
| A0A0A9DB86 | 14-441 | None |
| A0A2K0UPJ1 | 7-333 | None |
| A0A5C6SP72 | 114-736 | None |
| A0A2N0PUI6 | 490-1102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.