DPCstruct | MC44425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 125 ± 15 aa |
| Standard deviation of domain lengths | 14.60 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05210 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5D4S9 | 29-159 | RFQCFYCGKWFSDSENIRGSCKEAPDNVEHLIRIFTCYPVAQAAVYHCCKSNGELLTNISHYGQGYNLFAFGSRNTSILKRLKRLLF… |
| A0A182SHI6 | 1-109 | RYCQEFYNDEWNHKGSCDYAPDCFRTAIENVSGMPCARCMLYHCMKDAEGETVAHPCLCTGESGCTKRWIGLALLSLLVPCLWCYPP… |
| A0A6H5GU86 | 351-466 | None |
| S9WB49 | 182-280 | None |
| A0A498MN17 | 89-227 | None |
| T1FAB5 | 635-746 | None |
| A0A164Z3S8 | 473-597 | None |
| A0A1I7ZSI4 | 462-589 | None |
| A0A2U9BN28 | 1109-1222 | None |
| A0A6P5JJ38 | 159-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.