DPCstruct | MC44424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 195 ± 43 aa |
| Standard deviation of domain lengths | 43.30 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 66.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.68 |
| Pfam Score | 91.95 |
| Assigned Pfam label(s) | PF12253- PF11600- PF15539 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5D4M5 | 247-439 | VSLAPHIRRDPLSADVHDNLLQIPPPVCFTLNLKKSKLFQFHDNWRPAYYGTWRKQSHFITGRRPFAKDTMFFDYEVDSDEEWEVPE… |
| H2ZDV8 | 2-161 | INIRAKLMQFCENNRPPYYGTYRKRSKYIRPRRPFIKDADLLDYEVDSDDEWEDPADGEDIANSDGEEDGDKDEDKEDDEGDGFFVP… |
| A0A1X2GB98 | 30-190 | None |
| A0A444XNW4 | 167-355 | None |
| A0A1X2IGP8 | 64-258 | None |
| J5RFD0 | 145-425 | None |
| A0A7S2XVB8 | 14-158 | None |
| H9G514 | 337-650 | None |
| A0A1B7MJ05 | 76-299 | None |
| A0A0D8YAW8 | 174-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.