DPCstruct | MC4442
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 89 ± 6 aa |
| Standard deviation of domain lengths | 6.41 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A437JYJ7 | 70-158 | GGWNDAEIDTFQRREVRFTRMGRAADAEHLAERLTLRDRQLDDRRLCLECSALTEGGRCHLAARGRLPGVSRRLEPVQTILQRCEGF… |
| A0A4D4JU48 | 3-96 | DQSADAHCWPHSNAMNTAEINRMALRIGMFQRRGLELLQAEALADSCMLRDREIDDRRACVECKHLQASGTCAAKQAALPKTMFHRC… |
| A0A3A3G376 | 56-136 | None |
| A0A519FHI5 | 2-94 | None |
| A0A543LKK6 | 67-162 | None |
| A0A431INF3 | 2-92 | None |
| A0A423S2U0 | 73-156 | None |
| A0A5A9XIT3 | 42-129 | None |
| A0A0Q6N4E2 | 62-149 | None |
| A0A369AR36 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.