DPCstruct | MC44417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 217 ± 31 aa |
| Standard deviation of domain lengths | 30.92 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5CM55 | 2-232 | RTAEQYWSPHTSDHLPFDANLISIIYENELLENLFMQKKVILLEFSQYFEHYLWPNFCAEQANNHYIMSIVIMLNEKFRERIPVWRS… |
| C6H8Y7 | 22-243 | NLAKTHWMKLSKAPKAKPEVIKNDLWDGLVSEKFAVRSLLILENLHILEKFLWPTYSEDSSNYHVLLIAVIAGVKQREHLPIWEHFT… |
| L8HF13 | 16-248 | None |
| A0A5K4F2S2 | 10-316 | None |
| A0A0D2MVS1 | 58-267 | None |
| A0A6A4PUY5 | 1-192 | None |
| A0A2W1BIW6 | 1-201 | None |
| A0A7J6UC64 | 255-473 | None |
| A0A1E4T619 | 1-192 | None |
| A0A2C5X980 | 27-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.