DPCstruct | MC4441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 101 ± 12 aa |
| Standard deviation of domain lengths | 11.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D4JCR7 | 2-87 | RIQALLNDQPVCTAGLDTRGFLSAHLNIEVRYSEPDAQNVLRLVGIETHKTESVHIDWPVVNVKEGDVVTLKLLPDGRSTEPVQMK |
| A0A7W7AVD3 | 3-95 | GFDICINDENVKAGLEAGVVVINIDVYNRISVCGVDYSNFASVNWIQSKLNPEDKIKVTVLDIDENSPFSVDVIDRQELLKEYKMLK… |
| A0A2Z3H8R2 | 9-124 | None |
| A0A6N3EUD3 | 1-125 | None |
| A0A7W0M9Z2 | 19-132 | None |
| B0BGX0 | 2-97 | None |
| A0A0G9HI75 | 1-90 | None |
| B0BG64 | 1-89 | None |
| A0A2V9XX28 | 17-130 | None |
| A0A3N4M7P6 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.