DPCstruct | MC44408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 238 ± 44 aa |
| Standard deviation of domain lengths | 44.49 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.51 |
| Pfam Score | 54.98 |
| Assigned Pfam label(s) | PF10355- CL0408- PF04819 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A080WGA9 | 69-285 | LAHFIMGSAFIAYGIILTILLLVGQFWLRSTGRSQEFFDSAVITAWGFVNTFTEHRWGSEWSHSDMQHTTMGIIWWCAGLLGMWLSR… |
| A0A818Z9K7 | 45-262 | YLSTTTFTCLCCPSSDKIPIESYVKIFCAIIGMLGEFFTGFTHLYNDTLKRKTWGFGENNAQHITMFLGFGLASLFEIFVHLKYSLP… |
| T1FQ63 | 11-206 | None |
| C1N8C2 | 32-274 | None |
| Q6C5B1 | 363-690 | None |
| A0A7J7QH37 | 71-268 | None |
| A0A3F3I9P0 | 45-231 | None |
| A0A7S3FS79 | 95-410 | None |
| A0A2P5XE18 | 1-216 | None |
| A0A4S4ETS1 | 335-586 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.