DPCstruct | MC44407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 248 ± 42 aa |
| Standard deviation of domain lengths | 42.44 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818XWZ1 | 14-289 | QQRQLPSQFHLVTWNTFKHHIPRLIIIIVVDLILPLIIYFSLASNIKPVYALLAAGIPPFLMVVFKAVWKRNFDSIGFIVCITFIFA… |
| A0A1F3SN69 | 11-195 | FLISFLPAILYWYLEAHYPVRTALIGGVTLSLIELTFEYFWTKEVHALSKFNFLLIIVLGGLSLAANEGLWFKLQPFFTGIFMSAFM… |
| A0A179HPY5 | 161-483 | None |
| A0A1L9UES0 | 9-295 | None |
| A0A2G7DVA3 | 54-261 | None |
| A0A0D2HE88 | 192-493 | None |
| A0A1I6QED8 | 5-205 | None |
| A0A0B7NGB7 | 72-292 | None |
| R1E5F8 | 10-209 | None |
| A0A1X0RHF9 | 2-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.