DPCstruct | MC44406
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 75 ± 4 aa |
| Standard deviation of domain lengths | 4.14 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 35.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T7CFT2 | 13-77 | FDVIYHDYTPLVHRMIRRLYIHSNHDDFLQVGYLSLWYAYRDYDEAKGPFSSYAFMRVKYEMLTM |
| W4QJ19 | 7-80 | FAEVAKQYEPLIRGQIKKLNIYRNREEFYQVGLIGLWRAYEQYDQEKGSFSTIALFKVRGCLLDFLRKEARYSE |
| A0A2T5SD86 | 2-76 | None |
| A0A6V7RMX4 | 1-78 | None |
| A0A6N8CPY3 | 9-83 | None |
| A0A7T6ZCB5 | 13-89 | None |
| A0A7X0LWY5 | 1-76 | None |
| A0A0B5S7K0 | 6-78 | None |
| A0A7H8S6Z7 | 2-83 | None |
| A0A177KM76 | 3-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.