DPCstruct | MC44405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 180 ± 31 aa |
| Standard deviation of domain lengths | 31.07 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.05 |
| Pfam Score | 88.44 |
| Assigned Pfam label(s) | CL0052- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4QIA8 | 408-579 | GRLLPGKMLLVDLEKKTIVPDEKLKKAYAKKHPYKKWLDQNLIPLHTLSPNSQSEEPITGDELVRLQAAFGYTVEEINKLIKPMVTD… |
| A0A287HCY2 | 43-231 | ASEVGVIPMDESKVVMKGRLGPGMMITVDLETGQVLENTEVKKNVASAKPYGTWLQESTRSIKPVNFQSSPVMDNETILRHQQAFGY… |
| A0A0G4KM02 | 412-595 | None |
| A0A811EBX1 | 394-577 | None |
| A0A2X2ECS6 | 166-359 | None |
| A0A1C6I1V6 | 18-145 | None |
| A0A0B8P763 | 221-435 | None |
| A0A0Q9XCL6 | 452-638 | None |
| A0A2R7RNQ8 | 236-449 | None |
| A0A212DLH0 | 162-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.