DPCstruct | MC4440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 149 ± 20 aa |
| Standard deviation of domain lengths | 19.57 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B3NDF6 | 9-158 | HDEPDPYADWGGDWMMKDVIKWERLHVIRPLAPAVLTREQCHRFVRTVSHHLGVKIPDLTFRPGALCAADLSGSMTLADWGATQQAI… |
| A0A537Z941 | 16-160 | VPRPRDSQRSRVYRAEMPMPASPLPGLPACAVFAERVVGTLWWTARFPELTLDRIPRLRPGNGARQAFYREDPDGPTITLPRRYRTK… |
| A0A661DHL9 | 5-122 | None |
| A0A3S0SEI4 | 2-147 | None |
| A0A1L3SXP2 | 1-129 | None |
| A0A354XPC3 | 7-168 | None |
| A0A6L6EZK7 | 71-236 | None |
| A0A0J6VTZ8 | 5-162 | None |
| C5B4Q3 | 4-146 | None |
| A0A2N5KU36 | 7-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.