DPCstruct | MC444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 174 ± 25 aa |
| Standard deviation of domain lengths | 25.20 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04336 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6VBK6 | 1-198 | MNFLAHCALADEASDLWQVDTKQHQGLLAGAVIADFTKGRINPLWPDALQAGIRLHRRIDAVSNQHPGIRTSCQRFPQSLRRFAPIF… |
| A0A432K0R7 | 2-183 | NFLAHLKLSGDHEKIMIGNFIADHIRGNKIHHFPEEIKEGIMLHRKIDYYTDHHPAFIQTRTRLHKKYHKYAGVIADIFYDHFLARN… |
| A0A6N2CS37 | 7-193 | None |
| A0A3D1EIC5 | 14-212 | None |
| A0A1J0LPC1 | 2-184 | None |
| A0A5B0E4Z6 | 2-183 | None |
| A0A3D3P1D0 | 58-252 | None |
| A0A327R2D8 | 53-244 | None |
| L7Y5X2 | 1-188 | None |
| A0A7V4KSA8 | 121-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.