DPCstruct | MC44399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 144 |
|---|---|
| Mean domain length (aa) | 136 ± 20 aa |
| Standard deviation of domain lengths | 20.42 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02566 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1T6C0 | 3-130 | TIHARYQGDLCCTAVHGPSAAELSTDAPKDNEGLGRYYSPTDLVATALATCILTTMGIVARRRGIDLKGASARVEKHMSTAPRRIGR… |
| A0A7W1PGN9 | 7-110 | SESSIRLVPDAGPMTIEAPKAEQQYSPFHMLGSSLAFCTFSVMYAWATHGKIPVDDLTLDVSWEFAEDPHRVGTIAVSFDWPSLPAK… |
| A0A433QCM2 | 81-218 | None |
| A0A5N6C513 | 50-187 | None |
| A0A1F4B506 | 34-185 | None |
| A0A6N8S6M0 | 2-134 | None |
| A0A366SAN0 | 322-470 | None |
| A0A7W0PQM2 | 1-115 | None |
| A0A2T6FXM7 | 241-384 | None |
| A0A1R4JVN4 | 13-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.