DPCstruct | MC44397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 7.29 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I9ZY67 | 2-72 | KKCKYIGVKEVMAQPMKAHEALQKGYKIGNSTPECNGFEVEYKDGYKSWCPAGVFIEAYKCADTFTDRLHI |
| R7AGS1 | 52-120 | VKKEESPMNKYIGTKMIEAEPMTKGVYNESRGRAVPGDPNDAGYLVKYQDGYESWSPKEVFDKAYMKVD |
| A0A6N2RK76 | 1-66 | None |
| A0A807ZFT3 | 4-72 | None |
| A0A660XEP3 | 1-63 | None |
| A0A533I678 | 1-74 | None |
| A0A146H001 | 110-197 | None |
| A0A1N7ALH9 | 1-81 | None |
| A0A5S4SIL2 | 101-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.