DPCstruct | MC44393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 97 ± 9 aa |
| Standard deviation of domain lengths | 9.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1HLU6 | 4-101 | KEKTKFPAATIAYYGPDDRTPVKIAVGIINEPGGDCVDIKRWAGANVVNDFKVSREILEFIKQHNVKTTITTNGIIGCIHEEGIDYV… |
| A0A0W0Z0G1 | 16-119 | KGFNGYPTASMAFYGPTNHMATKLVVGISYSEESEPMLFKWFNEAFDIRSHARILGEVTKLFASHKIKSITLMEKIFGCPHEEGIDY… |
| A0A2P6VUV5 | 41-143 | None |
| A0A0W1AP14 | 23-127 | None |
| A0A143PG75 | 10-108 | None |
| W5YRS3 | 1-71 | None |
| A0A7Y5W2Z3 | 486-581 | None |
| A0A661V5E3 | 22-123 | None |
| A0A225EAU8 | 133-236 | None |
| A0A7W8W794 | 4-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.