DPCstruct | MC4439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 95 ± 10 aa |
| Standard deviation of domain lengths | 9.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523A1G7 | 249-344 | GMRELLVNVSPLVDANELDLEDENVAGVYTVYVDQAVSMKVHASVALDTFHSTIAISMLDDFVIDVVDSIDHRVLEEEEDAPHYAID… |
| A0A1B3ND38 | 22-133 | LLPVYVIVRGEASESEDEAVPGIYLCYVDPSLSDGERAEVALDHFHENNGIGCLDDFSIRVVDADGNVLPRLEAYENGSRSAYGDYG… |
| A0A0F2QBX4 | 7-113 | None |
| A0A6J5DIP5 | 89-182 | None |
| A0A5E4W3G5 | 63-156 | None |
| A0A2S0N5R1 | 1-102 | None |
| A0A1C7LKK5 | 117-224 | None |
| A0A192A7R8 | 187-286 | None |
| A0A1H9RMN5 | 8-88 | None |
| A0A3D9VT79 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.