DPCstruct | MC44386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 122 ± 15 aa |
| Standard deviation of domain lengths | 14.93 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 33.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15532 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P1AAW9 | 25-142 | LAYRFRNIRGATYDRVIECIPQNATRRSLLPIPGKVTQGVEYKWRDRQDNTIRVRIHGPDPSAPLGSNARCGWVVRVQIAGRWLDYK… |
| A0A1E5KX71 | 1-105 | MSRIPKEANKRVLTPQPGKVTEGFEYTWKTSEGAKMTVRVHGPDASAPAGSNAANDWVVRVQQGKKYLDPISGEFQPPGISRPNSEF… |
| A0A841Z5T5 | 148-280 | None |
| A0A1H3MR74 | 124-238 | None |
| A0A523Q1U7 | 135-247 | None |
| F2NYM6 | 391-520 | None |
| A0A6B3W0X4 | 37-165 | None |
| A0A1N7GCD4 | 93-219 | None |
| A0A0B1Y918 | 2-94 | None |
| A0A1X7N0N1 | 227-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.