DPCstruct | MC44385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 265 |
|---|---|
| Mean domain length (aa) | 94 ± 19 aa |
| Standard deviation of domain lengths | 18.79 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 18.68 |
| Pfam Score | 50.44 |
| Assigned Pfam label(s) | PF02617- PF16320- PF00542- PF00510 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P1A984 | 30-107 | VEKEIRAKTEYEVILELVPADKKIAVLKAVRLLTDMGLKEAKDLVESTPAVIKRKVSGYEAEKIATKLRNAGATVSIH |
| W5W1I1 | 1-74 | MTWRVLVHNDAINSFAAVAYALVRVLSMPVEHAAAAARQAYESGVAEIGAYTEREPAEAITARLQAFGLNASIE |
| A0A3M1B6P7 | 557-651 | None |
| A0A831RMH7 | 16-112 | None |
| A0A2H6KGV2 | 21-137 | None |
| A0A563VVW5 | 685-782 | None |
| A0A1E3C1M3 | 248-340 | None |
| A0A7V2XJB8 | 418-509 | None |
| A0A438N9W1 | 446-564 | None |
| A0A1A8ZWL3 | 27-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.