DPCstruct | MC44383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 334 |
|---|---|
| Mean domain length (aa) | 244 ± 76 aa |
| Standard deviation of domain lengths | 76.05 |
| Length coefficient of variation | 0.31 |
| Mean AlphaFold2 pLDDT confidence score | 77.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.27 |
| Pfam Score | 73.40 |
| Assigned Pfam label(s) | CL0023- PF01556- CL0123- CL0159- PF00684 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A355AZM0 | 148-391 | IHRAYRRLAFEFHPDRHAGQLEMEARFKEIGEAYRALISGAGEDAPPTLDASDDLSARGRDLHFDIMVDFLEAAAGGEVGVRIQRPF… |
| K2CFP1 | 1-137 | MTIEFMEAVKGSEKSFVHQGRQYTVKIPPGSDDGTRIRYSEFDVSINVKPHKTFRREGNDVFIYHEIPLTLAILGGETSVPTLEGEL… |
| F6H935 | 123-342 | None |
| A0A0C2J3N5 | 3-146 | None |
| B0EIW1 | 6-169 | None |
| A0A1B0C165 | 31-368 | None |
| A0A6D2I0V1 | 402-745 | None |
| B0EUK2 | 590-757 | None |
| A0A654HC41 | 1-163 | None |
| K7F9P6 | 1-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.