DPCstruct | MC44379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 287 ± 61 aa |
| Standard deviation of domain lengths | 60.61 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9AAD2 | 425-726 | FAPLHPPKAEPVYKYTQESASSLPGTTAAHNLLAAIKQKCTPDEALKVLEDLPNPLTVDGSGDPPYHPLQIEVFTQTLLYLGSKTFS… |
| A0A022XZI6 | 16-258 | VITSIEEQAKTHGLTDPLIASTDVYVTSICYVGSKSLSHFLSCIERCKDRLLAIGPKSDAARRQIINSVMDYWVDQPGIGINIIDKM… |
| A0A2A2K1X5 | 586-820 | None |
| A0A151T923 | 263-553 | None |
| A0A061QL87 | 2-269 | None |
| A0A7R9UE56 | 772-1168 | None |
| A0A7S3J7U1 | 2-234 | None |
| K8EBJ4 | 428-804 | None |
| A0A7J6U8Q7 | 225-514 | None |
| T1GNS6 | 1-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.