DPCstruct | MC44375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 176 ± 22 aa |
| Standard deviation of domain lengths | 21.57 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 37.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05640 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9A3Z1 | 5-183 | SVRCYFLTCCALQLVSTAERQVFDLLGYLWLPILLNFVHILFTIIGIFGGYQARWKYVVSCASWNAFWIGWNIFLICLYLRVGVLQD… |
| A0A444TR84 | 1-149 | MWLPIICNFFNIIFTIFGFFGVYLYRPKYITVYLLWMFIWLAWNIFVICFYLNVGSLSNQSDWLNFGTGSASWWEINGIGCEPVYPT… |
| F7ARW8 | 1-206 | None |
| A0A443SM73 | 10-194 | None |
| A0A6I9MKM8 | 201-383 | None |
| A0A674K663 | 15-197 | None |
| A0A3M0JB31 | 4-175 | None |
| A0A813NPV0 | 1-226 | None |
| A0A5F5XT04 | 1-187 | None |
| A0A6A4KAI7 | 5-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.