DPCstruct | MC44367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 187 ± 37 aa |
| Standard deviation of domain lengths | 37.15 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7W993 | 11-139 | LSDIDLLRLSHYSRNMTDFNLISDLLPIIANIYFNGRLNGQQQQTTSFSLDLGQAAILLGVGLQRKSVDFVAKELELPIEQGYALLN… |
| A0A7R8X8S7 | 10-180 | KRLELYAKNLADYHLCMDLLPALARVYFLNQMGDVHLSPVQAGILMGLGLQHRTVDALAKEFEIPATQLLGLFNRIVRKILTFLNGV… |
| A0A7S0TGS0 | 141-328 | None |
| A0A3M7SBD9 | 44-243 | None |
| A0A803KW85 | 138-307 | None |
| A0A2H5S823 | 13-243 | None |
| A0A6A4VK79 | 171-384 | None |
| A0A837A6D0 | 187-305 | None |
| A0A1I8C298 | 739-860 | None |
| A0A6V7XDJ9 | 87-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.