DPCstruct | MC44363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 130 ± 13 aa |
| Standard deviation of domain lengths | 13.37 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844TBZ9 | 5-147 | STPPSPRSIRGRAVTVTDVEELLPEADRDFLSAAGYDHTIERVGQQVHVVIRNFPLPRYKPQNADLLIIVPSGYPNAKLDMFWTFPD… |
| A0A3R7HDI2 | 8-129 | LPEEDVDFLESTRLDWDSVTEGNIKRIVLKMFPVPTGYNHDKVDLNVRIEAAYPDTQLDMVYFYPRLARLDGKAIAATADDTFDGKT… |
| A0A1F4AYV4 | 6-130 | None |
| A0A2A3C8S2 | 119-267 | None |
| A0A3A5AQH8 | 31-190 | None |
| A0A2G7CXQ0 | 2-109 | None |
| L9YNK6 | 204-328 | None |
| A0A7Y8GXP1 | 97-241 | None |
| A0A1V5CT28 | 17-170 | None |
| A0A7V9KNE3 | 206-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.