DPCstruct | MC4436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 146 ± 20 aa |
| Standard deviation of domain lengths | 19.91 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 13.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19860 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A5BJR7 | 43-163 | PDIVGKQCQGFYLIQQQEGEDISDPANVAYFKFEDSWLKLHFDGETIFWRTGEVPSEPVNSCLSTCLVLLNLNELDGVVGRTLKKIT… |
| A0A7J5AQU7 | 6-152 | ENIVGQKIVKVVYSEVNDHEGSFYFDGFDTFDHAINIQMENGYCWNLGWKNDEYFEFDEGFFKKNKYIKEEEIITWEATNRWIKVLN… |
| A0A497ZJJ8 | 76-217 | None |
| A0A4V3DXK6 | 11-197 | None |
| A0A3A9ZHB1 | 116-255 | None |
| A0A7H8L552 | 18-145 | None |
| A0A7W5AR87 | 71-235 | None |
| L1PU67 | 2-148 | None |
| A0A1G9GIT2 | 12-177 | None |
| A0A1A9HIH6 | 13-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.