DPCstruct | MC44358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 161 ± 26 aa |
| Standard deviation of domain lengths | 26.13 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 42.52 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | PF13667- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376ETM7 | 31-173 | EIHLSPTRLTNGTMEENAPVTIYDTSGPYTDENASIDIMKGLPRIREQWILDRKDVDILNGITSEYGKARLADSRLDELRFGYDHKP… |
| A0A2R7QBU0 | 6-193 | GMAHPNSRRIFIEGSRPDIRVGLREIALADTLVGGSKEHPQFEANEPVPVYDTSGAYGDEHAVIDVRLGLPRLRQGWVLERGDTAAL… |
| A0A1B0C474 | 39-212 | None |
| A0A855HM57 | 1-150 | None |
| A0A379W0F0 | 25-188 | None |
| X0QY72 | 47-259 | None |
| A0A378H1B5 | 1-128 | None |
| A0A378CJN2 | 1-116 | None |
| A0A379AN16 | 1-127 | None |
| W0IQ09 | 4-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.