DPCstruct | MC44357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 109 ± 9 aa |
| Standard deviation of domain lengths | 9.19 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376ERC9 | 1-117 | MKLNIKNMVCSRCLKVLRQELEQLGIKVSSIELGVLVIDEMAGNHTEIMAKIESVLHTNKFEIIHSPEEVLVEKIKHFLLCKIEEPP… |
| A0A6N4EK17 | 2-116 | KIFKLHIKNMLCDRCIYVVRQILNQFNVLRVKIELGQVSFLSANEHIIPLLEKRLNEFNLQIIHSKDEQIIESIKLEVKRYLDEIEQ… |
| A0A1I6Y534 | 2-118 | None |
| A0A1D7XQP9 | 3-114 | None |
| A0A090WVY0 | 10-124 | None |
| A0A5B8UIU9 | 1-103 | None |
| A0A4Q3RQD0 | 4-105 | None |
| A0A3B8VN89 | 2-121 | None |
| A0A2S7KVT8 | 1-116 | None |
| A0A372DWT6 | 21-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.