DPCstruct | MC44349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 90 ± 17 aa |
| Standard deviation of domain lengths | 17.30 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 91.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11794 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V9UEZ4 | 17-91 | RTGDEFRQGLADGRRVFYRGRRIDDVVSEPELALAVDHSAICYDIAADRPDLAVAEVDGEQVSAFYVAPSNLSLE |
| A0A1J1EFF9 | 1-88 | MARTGAEYMEALKERPPNLWYKGERVQDPTTHPVFRGIVRTMAALYDLQHDPRYREVLTYEEEGKRHGMSFLIPKTKEDLKRRGRAYK |
| A0A077QDJ5 | 2-66 | None |
| A0A2N5GC85 | 19-118 | None |
| A0A0M1NXZ8 | 2-87 | None |
| A0A428WJC5 | 118-196 | None |
| A0A353G612 | 14-102 | None |
| A0A0F9ITH7 | 1-83 | None |
| A0A318WF84 | 2-101 | None |
| A0A0N0I4C5 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.