DPCstruct | MC44342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 116 ± 9 aa |
| Standard deviation of domain lengths | 9.38 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A354YVR8 | 54-157 | QELLTWAGHSKFCYSGSVEAGITLYFGKSQKRRIRAGLFAEMLEHFAGRNVKVGTSLSQPPRDSLGAWLMENFTKTAMASYVAPILI… |
| B2A5D0 | 4-115 | IPTIKPLSGRGKQISYKKLTHNLEITWGEAKFNVTKEQITHIMKNFFIDDGTWYPLGASMDQPIKGGLGEFIKENFKGLTPRHATAI… |
| A0A4R3MPG4 | 1-108 | None |
| G0JLP7 | 1-132 | None |
| A0A1D7ZSQ1 | 1-122 | None |
| A0A521G4W0 | 1-128 | None |
| A0A7C7QQ62 | 60-174 | None |
| A0A533RU67 | 1-120 | None |
| B2A7T7 | 91-215 | None |
| A0A417Z0A7 | 1-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.