DPCstruct | MC44336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 223 ± 30 aa |
| Standard deviation of domain lengths | 29.69 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.73 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0127- PF19361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A840W7E2 | 3-210 | VRYRLVGPDLASVRFAVSPLNELILSLRSWRDPGRFPIHLPWIRRLQQARDALDTEMLLALIDERLWTPDFLTPQPRSPLTRIEDEL… |
| A0A371PX12 | 3-238 | VRIHFSVEDLARTYVAERPDPLWEVLLSLHVLQSRHGAATFARWRQRTLSRLDGPARGLLALAPPSGYSPDFLTPDASARGLEEGLQ… |
| A0A7X3SKM9 | 13-222 | None |
| A0A345T725 | 194-405 | None |
| A0A0F7FUQ0 | 1-179 | None |
| A0A136KVC0 | 2-247 | None |
| A0A367FJV0 | 80-316 | None |
| A0A3E0Q4J6 | 68-380 | None |
| A0A2Z5JG03 | 211-457 | None |
| W6JWC5 | 3-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.