DPCstruct | MC44333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 547 ± 42 aa |
| Standard deviation of domain lengths | 42.16 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S3ESJ1 | 267-819 | NLTKKIENLARSAPQHKIEQDLARRLDEIFTTRRRAAYSRILSMPKIEEINTRGDRALIVLSPDAKIPPGKAQQLFNASHDRNNFAI… |
| A0A7C2W9I5 | 1-520 | YIFEEEGRTRTYRNTVVVLYPSDESLIDRLLNEVKKYIAANKVLDEINQIYPDETIRKIQKNKANTYIGTKYGEILRRTLSALDTIA… |
| A0A832CFS8 | 1-560 | None |
| A0A2R7Y748 | 473-1041 | None |
| A0A831K6E5 | 17-469 | None |
| A0A1Z5HDJ1 | 154-702 | None |
| L9Y0X4 | 383-948 | None |
| A0A662HX87 | 571-1177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.