DPCstruct | MC44327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 266 ± 52 aa |
| Standard deviation of domain lengths | 51.86 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 90.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 32.02 |
| Pfam Score | 98.48 |
| Assigned Pfam label(s) | CL0475- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L8M6N6 | 178-477 | GGLAEEITKGADTLLAMVKDPECKVFLTLSGAMTIAKMGLIICDMVDLGIIDSICSTGALMAHGLVESVGLKHFKYDPNEDDANLAD… |
| A0A813B0C4 | 9-233 | GGIEEDFMKCFRPHYLGDFELKGSELRMRGINRIGNLLVPNNNYCKFEDWFSPLLHEMHDEQEKYGTVWTPAKMIARMGEAINHEDS… |
| A0A1P8BA27 | 10-174 | None |
| A0A838UTN2 | 217-472 | None |
| A0A524HY82 | 5-230 | None |
| A0A2H6KDI8 | 56-369 | None |
| A0A453DTU1 | 59-315 | None |
| A0A182FFE2 | 49-357 | None |
| A0A3M1QIJ7 | 182-402 | None |
| A0A4W6DZN1 | 20-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.