DPCstruct | MC44320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 168 ± 26 aa |
| Standard deviation of domain lengths | 25.59 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7AS50 | 23-181 | AREIAEILNADKSTINRILYKDDRFVSLGSTPPRWKVKAVIPVYKEKEEYKQLDKWEGIPGYLGYKVGVSGKFARQRRDILDRIMTR… |
| A0A2E8REZ8 | 13-107 | APAEGIMSTMGYRVGDTQGIRKEYRINIMIDVLTEPLPFVESPSYMQEWGEEKTIMRYNKLKNFLSGEINSPLQRNNYRAISEWKED… |
| A0A444K6V5 | 132-307 | None |
| A0A257HQ63 | 4-148 | None |
| A0A844AFG3 | 118-315 | None |
| A0A2W4VYU5 | 238-417 | None |
| A0A442VJ17 | 189-383 | None |
| A0A0C1H3Y1 | 11-218 | None |
| A0A4Z1BKS5 | 14-210 | None |
| A0A7W4YXU4 | 109-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.