DPCstruct | MC4432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 195 ± 21 aa |
| Standard deviation of domain lengths | 20.57 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 19.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07114 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F8H2K3 | 3-158 | LYTYGPLYIGTTSSCCGILANYLFRNCMKVKQHPFQTFVPLSAIPFLTAAVIYKFLVTDYLSSGELTVDSCLLRGAFVSAICGVFHP… |
| A0A0N0BDB5 | 11-202 | SDGDIVASRKKLISNWEPKREVWALKYGAALTAGIAGINGIVLNSIFRRKLKLRYNGLKFSMIFLSTGSAVLAYVSHETYVTEQIVL… |
| A0A1I8J6G6 | 605-798 | None |
| W2SG50 | 39-264 | None |
| A0A183KES8 | 10-205 | None |
| A0A7J6AGC9 | 138-326 | None |
| A0A7R9FRI8 | 15-214 | None |
| A0A154P217 | 2-150 | None |
| A0A1D1W4Z6 | 13-217 | None |
| F6Z8Y8 | 91-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.