DPCstruct | MC44313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 260 ± 53 aa |
| Standard deviation of domain lengths | 52.93 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 20.52 |
| Pfam Score | 87.19 |
| Assigned Pfam label(s) | CL0722- CL0697- CL0051 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6JJT3 | 169-416 | LTDYTMEEFFRFAKETPVEDLYFIREAYRVNLELAKAALTSERCTLTKSLLAFNGGTDVSGDLRATARFFAGAASEARVLGLDKPAM… |
| A0A376VM99 | 2-246 | RVPGTQFQLDPVQAAFNIGAMIRWLDFNDTWLAAEWGHPSDNLGGILATADWLSRNAVASGKAPLTMKQVLTAMIKAHEIQGCIALE… |
| V8QVV8 | 1-249 | None |
| A0A7J2L367 | 62-303 | None |
| A0A4Q4ZLC0 | 807-1010 | None |
| A0A2Z2PGS7 | 4-254 | None |
| A0A560FP59 | 16-267 | None |
| A0A365MRJ4 | 3-305 | None |
| A0A2N3S4H6 | 315-659 | None |
| A0A2N3SJK9 | 1-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.