DPCstruct | MC44310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 257 |
|---|---|
| Mean domain length (aa) | 224 ± 54 aa |
| Standard deviation of domain lengths | 53.68 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 89.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.35 |
| Pfam Score | 99.12 |
| Assigned Pfam label(s) | CL0056- CL0364- PF18596 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z8LXM0 | 17-227 | DENSPRELPIDPVNIYHTATIEKDGYFESRVDLSGHCSTHIDVPCLMYKNGFTVADIPIEKLFGRSILIDLSENKRPGDAITAEDLQ… |
| A0A023G4U2 | 6-175 | HFNKHGWSASEIPLDRLLMVPIALIDVQQEAARNASYLMPVAEVLRWEAQNGPLPSNCLLLIRSGWSKYYNNRNAFYGVDQYGIRHI… |
| A0A2H4S7Y8 | 311-606 | None |
| A0A3E0CX78 | 149-370 | None |
| A0A7E5VAR3 | 14-195 | None |
| A0A6A3AV24 | 624-837 | None |
| A0A2T0Q1S2 | 48-314 | None |
| A0A177V0K3 | 83-433 | None |
| A0A2V6TQH8 | 1-184 | None |
| A0A1J5L8N9 | 2-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.