DPCstruct | MC44308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 118 ± 10 aa |
| Standard deviation of domain lengths | 10.44 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.91 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | PF19439- PF09758 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A392PFA6 | 1-121 | MIQTAIRSLVLNICNVSDDMVYQFILTPPVSEYFSDLVHRLRDLCFCLDVILHDKGEMENKKRRNGLILQSDKIVDELYYFKDILSV… |
| A0A6N2MVQ6 | 165-279 | LYSEALKFTQHGEKMIQTAIRALTLNIYNVSDDMVYQFITTPPFSKYFSDLVHSLKEQCIHLDNLVHALEEMGINQRRKELLLKTDR… |
| A0A540KKB6 | 90-200 | None |
| A0A3P6DU94 | 389-508 | None |
| A0A4S4E2T0 | 176-294 | None |
| A0A078HMP2 | 354-500 | None |
| M8CR96 | 46-151 | None |
| A0A835K536 | 195-315 | None |
| A0A2G2XIJ2 | 562-666 | None |
| A0A2K3N198 | 1-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.