DPCstruct | MC44307
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 111 ± 11 aa |
| Standard deviation of domain lengths | 11.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A392PB78 | 1-101 | MCTELKKLVDRVLKIFPQIEEARPRSSSGIPALVLLTSTLDKAKQLLHYCSDSSKLYLAMTGESILSKCQKTRKSLEKSLVQIQDIV… |
| A0A6A6KP51 | 1-115 | MGTLPYLYSFKAHRSICTELMKLVDRIGRVFPEIEAARPRCASGIQALCLLNGTIEKARQILRYCCESSKLYLVITGDVIISRCQRS… |
| M7YM22 | 71-188 | None |
| M7Z8E1 | 2-132 | None |
| A0A2Z7DD94 | 3-107 | None |
| A0A446NXE9 | 1-98 | None |
| A0A7N2M0S1 | 22-141 | None |
| A0A498HNG9 | 23-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.