DPCstruct | MC44304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 235 ± 69 aa |
| Standard deviation of domain lengths | 69.19 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 87.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.66 |
| Pfam Score | 95.74 |
| Assigned Pfam label(s) | CL0029- CL0288- PF17042- PF02615- CL0377 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7UAY6 | 341-568 | ARPLLTDDPHARLSALGFGEKDVRTLADHFLDAERRGKRGHGLTRIDWLETLDGFDPRAEPECVLSEPGFQRWEGRGALGYLTLAAI… |
| A0A447XZY3 | 9-279 | AQTLHSFIQAVFRQMGSEEQEAKLVADHLIAANLAGHDSHGIGMIPSYVRSWSQGHLRINHHAKIVKEAGAAVTLDGDRAFGQVAAH… |
| A0A1Q4DI03 | 1-144 | None |
| A0A1V1NRZ7 | 44-195 | None |
| F2KIU3 | 19-205 | None |
| A0A0S7DU61 | 271-576 | None |
| A0A1A9UIQ2 | 5-173 | None |
| A0A3D8QS93 | 11-304 | None |
| A0A482VS32 | 81-398 | None |
| A0A813VWC4 | 33-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.