DPCstruct | MC44298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 75 ± 6 aa |
| Standard deviation of domain lengths | 6.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 48.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H3NGF1 | 1-76 | MDQLYMTVQDYLLKFRKISSLESLEKLFDHLNYTLTDDMDIVNMYRAADHRRAELVSGGRLFDVGQVPQSVWRYVQ |
| A0A090N9Z5 | 26-99 | SAGIKMAKTKQEWLYQLRRCSSVNTLEKLIHKNRDSLSNSERESFNSAADHRLAELITGKLYDRIPKEIWKYVR |
| J7QY06 | 75-154 | None |
| A0A2X5BLV9 | 143-210 | None |
| A0A6M3HFK8 | 69-133 | None |
| V0UIN3 | 41-117 | None |
| A0A6P1PY11 | 7-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.