DPCstruct | MC44296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 188 ± 30 aa |
| Standard deviation of domain lengths | 30.17 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4HPE9 | 45-206 | TAGRSLLGLVVAFPLPALAASKLSPTDRLLTGYKDIVYLLENWDKETTKCESPTKCVRDADVVRKYLGLRSTKDPLFQAEKTIQQLQ… |
| A0A0M0JAD9 | 2-168 | ISVQKIEAGLAVLDDVVARWAELTTDCNYGEIRRELLETANKEALLKAATQTSKSETMVTMCKATGRLVREAIGADKSPLSGIDKVL… |
| K0RIV3 | 1-227 | None |
| A0A812Z529 | 305-486 | None |
| B7FPR1 | 38-235 | None |
| R1BWX3 | 4-169 | None |
| A0A7S2QPZ2 | 1-153 | None |
| A0A1E7FSF9 | 37-251 | None |
| A0A812JK41 | 4-140 | None |
| A0A7S4AX14 | 87-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.