DPCstruct | MC44295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 142 ± 19 aa |
| Standard deviation of domain lengths | 18.73 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4HNB0 | 1-123 | MSAGRADTHTGLRAALPVLFKAANPVSEAVAEMANGKDSFGMAWLILCSVAKNIASLPLEILDFSGCTLEPSKLFLLLSFLPAGTQE… |
| A0A0G4H1U4 | 197-323 | KRAKTRDEVLALFLQRLALTSETLSDLARQRESFGLAWLGVFLCQKTKRLDKVSVSPPSSFDLSGTRRICPEKVSLMLDQIPPSALD… |
| A0A0G4GTL6 | 1-152 | None |
| A0A0G4G1G7 | 749-869 | None |
| A0A0G4G0Y3 | 1-118 | None |
| A0A0G4FTX3 | 19-170 | None |
| A0A0G4FN25 | 1-162 | None |
| A0A0G4FJG5 | 1-149 | None |
| A0A0G4F2E4 | 140-263 | None |
| A0A0G4FBP2 | 18-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.