DPCstruct | MC44294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 155 ± 17 aa |
| Standard deviation of domain lengths | 16.79 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 47.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4FN17 | 1-124 | MKQEYSSTLLAMQLAVQERVQVFPWLLNHRDRNGCVVIPSGVVLSFAKINQRLEDLLLDSDDAEWEIADPAKVIMIVNALMDDQRMK… |
| A0A0G4HHX3 | 130-286 | KQEYSSTLLVMQLAVQERVQVFPWLLDYRDRNGRVVIPSGVVLSFAKIDQRLEDLLFDSDDAEWEIADPAKVIMIVNALTDDQRMKL… |
| A0A0G4FW25 | 4-152 | None |
| A0A0G4GJ54 | 13-166 | None |
| A0A0G4GCR8 | 15-200 | None |
| A0A0G4G9I9 | 2-157 | None |
| A0A0G4G6Z5 | 139-297 | None |
| A0A0G4G5L0 | 2-161 | None |
| A0A0G4G1I0 | 158-315 | None |
| A0A0G4HQT5 | 6-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.