DPCstruct | MC44293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 149 ± 31 aa |
| Standard deviation of domain lengths | 31.49 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.98 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | PF10273- PF05056- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4H905 | 1-169 | MENRDEVFSRAVASVFSNWTLLNLAVDGGWGGRQSRKKCIDLFEEVIDKFRRGERFGADGLADFLFHRIAKLFSTSCEDGSVEEVAA… |
| A0A0C2CZU7 | 7-96 | SSNEWKSIVCRVIASWGGYQLGVDFSSGGPETLAKDEWFKDVLAEYIFTTRGLKAEDLEDWLNNILYTEFNLILEDDSVYPTSLLLI… |
| A0A4U0VME3 | 643-829 | None |
| K8EBP8 | 90-267 | None |
| A0A7M3RPX8 | 81-264 | None |
| A0A835HMI3 | 44-242 | None |
| A0A183J656 | 2-177 | None |
| A0A369RRC2 | 5-169 | None |
| A0A2U1M9F4 | 90-239 | None |
| A0A2K3NPR8 | 230-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.