DPCstruct | MC44292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 411 ± 74 aa |
| Standard deviation of domain lengths | 73.56 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 31.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6YUT1 | 63-515 | EPLCPPGTIARDNWPERGPTYGSVFQTMEGGLGYWAGNRFHYGPPKFSLNATPNCYSTEVASPGWPFFHSSEPLPDDMLGIAQVSNR… |
| A0A0G4GUG0 | 42-451 | RTTPCNRLGLVALSNRLLILPDGQTLSKEGMLGTAYIKTPFGKTHKGDTRNFWTTVVDTENFSGPVSYFLPEYWSVRHTGWEKQSAH… |
| A0A6C2TVN9 | 578-1023 | None |
| A0A6L8LBQ5 | 381-844 | None |
| A0A2E4VBY6 | 182-636 | None |
| R1DAD4 | 133-600 | None |
| A0A7V3T2W0 | 1-303 | None |
| A0A517NYM5 | 107-566 | None |
| A0A381ZCQ1 | 95-544 | None |
| A0A2D6VCT5 | 255-732 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.