DPCstruct | MC4429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 490 ± 142 aa |
| Standard deviation of domain lengths | 141.63 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 75.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 18.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K6Y9P8 | 2-454 | KVIVAIGNSELWEQFALSQADNVQSLNQLSGEGGKGSQVCVVEALEDAQQLVRTGIQLSNFSVVIFYQQAEHYIASNIQRGLTLEEA… |
| A0A2K9RC42 | 8-319 | LKKALSEKDYLINSLNEDSLALQVQLEISQGKSAQLAVDNAALNVRVNELEEGYQTKNSELAMLSKLFFKSEENSQRIAAQLKKSHL… |
| A0A6F8U6E7 | 1-246 | None |
| A0A3A1P251 | 253-518 | None |
| A0A370DZU3 | 102-592 | None |
| A0A345ZGL3 | 1-504 | None |
| A0A1Q8T5P6 | 145-497 | None |
| A0A011NI14 | 1-463 | None |
| A0A7B7BWR2 | 17-290 | None |
| A0A6L9FWL9 | 67-624 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.