DPCstruct | MC44286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 85 ± 12 aa |
| Standard deviation of domain lengths | 11.81 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484AS23 | 9-75 | EPKEPIVRTKTIPGPKSTELKSQLSTVQSTGTIQFFADYEKSAGNYIFDVDGNALLDVYTQISSVPL |
| A0A0D8XXL3 | 34-123 | FAAMFCRVARQVTLTHSARNVTIIASQEPAGPLIRSKVPGPESVALKQKMEPLHQTTSVRIFVDYDKSFGNYMVDADGEQITLTFLR… |
| A0A0N4TG48 | 3-70 | None |
| C1BLG5 | 18-96 | None |
| A0A3B3QAD1 | 26-107 | None |
| A0A6A4K3N0 | 8-96 | None |
| A0A1B0BXA8 | 126-213 | None |
| A0A2P8Z039 | 13-104 | None |
| A0A7M6DRF7 | 21-99 | None |
| A0A0N4TAH8 | 2-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.