DPCstruct | MC44284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 164 ± 31 aa |
| Standard deviation of domain lengths | 31.06 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01496 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D8XW58 | 27-173 | KSLYNRGLPLPVGHSHGDDVHEFNFADVMVYQAIHTIEFALGCISHTASYLRLWALSLAHAQLSEVLWDMLLSIGLTMGGWTGSVAI… |
| A0A812Z650 | 2-110 | IETIEFVLGTVSHTASYLRLWALSLAHQQLSLVFFNLILLSGMAMPLPLNIFAMYFCFALWFVVTLAILGGMDVMECFLHTLRLHWV… |
| A0A200R623 | 126-242 | None |
| A0A2H6K6U7 | 749-888 | None |
| A0A6A6LIW4 | 1-129 | None |
| A0A7S2MSJ1 | 236-381 | None |
| A0A4Y7KZT5 | 136-314 | None |
| A0A182F8F2 | 1073-1272 | None |
| A0A2U1QCE0 | 925-1126 | None |
| A0A7S4NSI7 | 47-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.