DPCstruct | MC4428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 219 ± 35 aa |
| Standard deviation of domain lengths | 35.11 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05890 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672T7Y5 | 1-215 | MVEIDEDPQMGFESEEDDDELSDGELQEAFAKGLLKPGLNVPLLEPKKAINNVEGLRKCLAEFKRNLPWAERLDLTNYPAVDIVAKA… |
| A0A0M0J924 | 5-170 | PRASSSNEAALLLKLEQLTGGIDPEKSDETWVESLVVTAPEPLQLDDPDDDLKRELAFYNQALSAVRVAQERLDRLGIPHVRPDDYF… |
| T1GHT4 | 9-234 | None |
| A0A162QPZ8 | 1-205 | None |
| A0A7M3RFN2 | 12-219 | None |
| A0A0K0E6X6 | 1-155 | None |
| A0A182TVQ9 | 29-246 | None |
| E1BSA2 | 206-461 | None |
| H2N7Q8 | 13-235 | None |
| A0A1X2GK11 | 1-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.