DPCstruct | MC44277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 105 ± 13 aa |
| Standard deviation of domain lengths | 12.60 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A454XW24 | 10-113 | RYQSLTPILKTPLSDTLALPLSQQGRLCGFFEAQFYKCMEAYGAKLGRKYCDFENRDFNECVTGDKQKMRSEAIRAQRIKLYKEGKL… |
| A0A0D8XLX5 | 8-95 | NSRPCGFFEAQFFHCMEAYGAKLGRMYCDLELRDFKECMTGDKQRKRAEAIAAQRKKLYREGKLDKPFLDDHPQPGQCYPDYFERKEE |
| A0A7R9JBL5 | 141-254 | None |
| A0A1Y3EVG5 | 12-112 | None |
| A0A835GPK8 | 1-106 | None |
| A0A7R9A7D6 | 5-105 | None |
| F4WG49 | 66-160 | None |
| A0A182M7T3 | 120-232 | None |
| A0A044V176 | 25-129 | None |
| A0A7R8VH47 | 387-477 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.